PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 283aa    MW: 32550.2 Da    PI: 4.6666
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-51608PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.5e-1866119356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++ +eq++ Le+ Fe ++++  e++ +LAk+l+L+ rqV +WFqNrRa++k
  Lsa007834  66 KKRRLMAEQVKFLEKSFEVENKLEPERKIQLAKELNLQPRQVAIWFQNRRARYK 119
                4557889**********************************************9 PP

2HD-ZIP_I/II125.81.9e-4065156192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl +eqvk+LE+sFe e+kLeperK +la+eL+lqprqva+WFqnrRAR+ktkqlEkdy++Lk+ yd+lk + + L+k++++L+ e++
    Lsa007834  65 EKKRRLMAEQVKFLEKSFEVENKLEPERKIQLAKELNLQPRQVAIWFQNRRARYKTKQLEKDYDFLKSDYDKLKLHFDCLQKDNNKLKIEVQ 156
                  69*************************************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1954123IPR009057Homeodomain-like
PROSITE profilePS5007117.0761121IPR001356Homeobox domain
SMARTSM003893.9E-1664125IPR001356Homeobox domain
PfamPF000463.6E-1566119IPR001356Homeobox domain
CDDcd000863.31E-1566122No hitNo description
Gene3DG3DSA:1.10.10.602.3E-1868128IPR009057Homeodomain-like
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PfamPF021835.8E-16121162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEDEMVFEDS NNITSFLNPS SQVLDSLWIS TSSSNSFHGE TNTTTTMAPV IGGETQDENY  60
YGQPEKKRRL MAEQVKFLEK SFEVENKLEP ERKIQLAKEL NLQPRQVAIW FQNRRARYKT  120
KQLEKDYDFL KSDYDKLKLH FDCLQKDNNK LKIEVQLLKE KLVERAKAKQ ESLECGIPAK  180
ELESKGGKQN PIPMATQNGT NVVICKNEDA NSVSAKSDIV DSNSPRQDSS HLLENQSDFS  240
QDEDDNVSGN VLRFQKSEYE SYFEMSESGL GYPIVDQSFW LWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARYKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766848.17e-73PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_016436508.17e-73PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022831e-42HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A103YAI11e-133A0A103YAI1_CYNCS; Homeobox, conserved site-containing protein
STRINGPGSC0003DMT4000454717e-70(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-43homeobox 1